Loading...
Statistics
Advertisement

Destination Weddings and Honeymoons Just for You | 1-888-700-8747
www.wedmoon.com/
1-888-700-8747

Wedmoon.com

Advertisement
Conversion Technology Metas Server
Wedmoon.com is hosted in United States / San Francisco . Wedmoon.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 4. First javascripts: Gprofiles.js, Wpgroho.js, 725X1342.skimlinks.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Wedmoon.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 4
  • gprofiles.js
  • wpgroho.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Wedmoon.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 334601970365591484320680441873593189693055
    • validFrom: 160404130800Z
    • validTo: 160703130800Z
    • validFrom_time_t: 1459775280
    • validTo_time_t: 1467551280
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: E8:85:FE:02:CB:07:18:96:64:2A:57:EE:71:A3:B5:2D:8D:BD:2E:88
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:tls.automattic.com, DNS:wedemandareferendum.net, DNS:wedemangallery.com, DNS:wedennials.com, DNS:wedesignyourresume.com, DNS:wedgehammer.com, DNS:wedgeheadevents.com, DNS:wedgeintheround.com, DNS:wedgiefoodie.com, DNS:wedgwood.io, DNS:wedgwoodinseattlehistory.com, DNS:wedham.com, DNS:wedindependent.com, DNS:wedindie.com, DNS:wedinlondon.com, DNS:wedinthesun.org, DNS:wedinvancouver.com, DNS:wedkarskiblog.com, DNS:wedmelove.com, DNS:wedmoon.com, DNS:wednesday-addams.com, DNS:wednesdayconfessions.com, DNS:wednesdaydevotional.com, DNS:wednesdaylens.com, DNS:wednesdaylupypciw.com, DNS:wednesdaymiddaymedley.org, DNS:wednesdaymissives.com, DNS:wednesdaymorningdevotional.com, DNS:wednesdaynightcubs.com, DNS:wednesdaynitelivepalmsprings.com, DNS:wednesdaysathome.com, DNS:wednesdayswithme.com, DNS:wednesdayswoefulchild.com, DNS:wednesdaywail.com, DNS:wednesdaywarriorgirl.com, DNS:wednesdaywonderings.com, DNS:wednesdaywriting.net, DNS:wedobsessed.com, DNS:wedonotneedkidsfullstop.net, DNS:wedontneedoil.com, DNS:wedontneedoil.org, DNS:wedontsitoncouches.com, DNS:wedostyle.co, DNS:wedprops.com, DNS:wedrankhere.com, DNS:wedreamofbetterthings.com, DNS:wedreamofnicecream.com, DNS:wedressyouup.org, DNS:wedstrijdvisser.com, DNS:wedtin.com, DNS:weeappetit.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Wedmoon.com

Number of occurences: 12
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: twitter:image
    Content: https://wedmoon.files.wordpress.com/2013/01/wedmoon.jpg?w=1400
  • Name: twitter:card
    Content: photo
  • Name: theme-color
    Content: #e011c8
  • Name: application-name
    Content: Destination Weddings and Honeymoons Just for You
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: 1-888-700-8747
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Home | Destination Weddings and Honeymoons Just for You on WordPress.com
  • Name: description
    Content: 1-888-700-8747

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns2.wordpress.com
  • ns3.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sun, 12 Jun 2016 05:41:57 GMT Content-Type: text/html Content-Length: 178 Location: https://wedmoon.com/ X-ac: 3.fra _dfw X-Cache: MISS from s_hk1 X-Cache-Lookup: MISS from s_hk1:80 Via: 1.1 s_hk1 (squid/3.5.9) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sun, 12 Jun 2016 05:41:58 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.fra _dfw

DNS

host: wedmoon.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: wedmoon.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: wedmoon.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: wedmoon.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: wedmoon.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: wedmoon.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.edmoon.com, www.w edmoon.com, www. edmoon.com, www.wcedmoon.com, www.cedmoon.com, www.wedmoon.com, www.edmoon.com, www.wdedmoon.com, www.dedmoon.com, www.wfedmoon.com, www.fedmoon.com, www.wgedmoon.com, www.gedmoon.com, www.wbedmoon.com, www.bedmoon.com, www.wdmoon.com, www.wexdmoon.com, www.wxdmoon.com, www.wesdmoon.com, www.wsdmoon.com, www.wewdmoon.com, www.wwdmoon.com, www.werdmoon.com, www.wrdmoon.com, www.wefdmoon.com, www.wfdmoon.com, www.wevdmoon.com, www.wvdmoon.com, www.wecdmoon.com, www.wcdmoon.com, www.weqdmoon.com, www.wqdmoon.com, www.weadmoon.com, www.wadmoon.com, www.weydmoon.com, www.wydmoon.com, www.wemoon.com, www.wedtmoon.com, www.wetmoon.com, www.wedgmoon.com, www.wegmoon.com, www.wedbmoon.com, www.webmoon.com, www.wedxmoon.com, www.wexmoon.com, www.wedsmoon.com, www.wesmoon.com, www.wedfmoon.com, www.wefmoon.com, www.wedvmoon.com, www.wevmoon.com, www.wedymoon.com, www.weymoon.com, www.wedzmoon.com, www.wezmoon.com, www.wedamoon.com, www.weamoon.com, www.wedemoon.com, www.weemoon.com, www.wedrmoon.com, www.wermoon.com, www.wedoon.com, www.wedmpoon.com, www.wedpoon.com, www.wedmooon.com, www.wedooon.com, www.wedmioon.com, www.wedioon.com, www.wedmkoon.com, www.wedkoon.com, www.wedm.oon.com, www.wed.oon.com, www.wedmuoon.com, www.weduoon.com, www.wedmjoon.com, www.wedjoon.com, www.wedmnoon.com, www.wednoon.com, www.wedm-oon.com, www.wed-oon.com, www.wedmon.com, www.wedmobon.com, www.wedmbon.com, www.wedmohon.com, www.wedmhon.com, www.wedmogon.com, www.wedmgon.com, www.wedmojon.com, www.wedmjon.com, www.wedmomon.com, www.wedmmon.com, www.wedmo on.com, www.wedm on.com, www.wedmovon.com, www.wedmvon.com, www.wedmon.com, www.wedmoobn.com, www.wedmobn.com, www.wedmoohn.com, www.wedmohn.com, www.wedmoogn.com, www.wedmogn.com, www.wedmoojn.com, www.wedmojn.com, www.wedmoomn.com, www.wedmomn.com, www.wedmoo n.com, www.wedmo n.com, www.wedmoovn.com, www.wedmovn.com, www.wedmoo.com, www.wedmoonn.com, www.wedmoon.com, www.wedmoonh.com, www.wedmooh.com, www.wedmoonj.com, www.wedmooj.com, www.wedmoonk.com, www.wedmook.com, www.wedmoonl.com, www.wedmool.com, www.wedmoon .com, www.wedmoo .com,

Other websites we recently analyzed

  1. nllaw.com
    Kirkland (United States) - 98.124.199.105
    Server software: nginx/1.6.3
    Technology: Html
  2. Data Warehouse Appliance from Dataupia
    Dataupia's data warehouse appliance delivers unprecedented access to business-critical data by augmenting an organization's existing data management systems. Unlike other solutions that displace existing technology or specialize in one kind of data access, the Dataupia™ Satori Server offers a transparent, non-disruptive, continuously scalable, and affordable means to expand data management capabilities across a broad range of mixed workload environments.
    Reston (United States) - 207.58.152.61
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Php
    Number of meta tags: 3
  3. Sogn Synssenter
    Sogn Synssenter er en del av Alliance Optikk som er en landsdekkende optikerkjede - Vi er Din Fastoptiker som tar ansvar for dine øyne og ditt syn hele livet.
    Norway - 193.93.255.224
    G Analytics ID: UA-554495-26
    Server software: nginx
    Technology: DoubleClick.Net, CSS, Html, Html5, Javascript, jQuery, jQuery UI, MediaElement, Php, Pingback, Swf Object, Facebook Retargeting, Google Analytics, Google AdWords Conversion Tracking, Google Remarketing, Wordpress, Facebook Box
    Number of Javascript: 34
    Number of meta tags: 5
  4. Trading Coach | Asistentedebolsa.com
    Dublin (Ireland) - 176.34.117.102
    Server software: Apache
    Technology: CSS, Html
    Number of Javascript: 6
    Number of meta tags: 3
  5. Home | Scenic Airlines
    Scenic Airlines offers Grand Canyon tours from Las Vegas aboard the largest and most experienced aerial sightseeing company in the world. Visit us online for more info.
    Ashburn (United States) - 52.1.145.167
    Server software: nginx/1.8.0
    Technology: CloudFront, CSS, Font Awesome, Html, Javascript, jQuery, Crazyegg, Google Analytics
    Number of Javascript: 6
    Number of meta tags: 7
  6. KeDos GrafikDesign
    Websets und Forenstyles
    Germany - 178.254.57.44
    Server software: Apache
    Technology: Html
    Number of meta tags: 5
  7. thuisbezorgd.nl
    Netherlands - 185.10.49.191
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  8. Aufgabenorientiert.de
    Germany - 88.198.231.2
    Server software: Apache/2.4.10 (Debian)
    Technology: CSS, Html, Html5, Javascript, jQuery
    Number of Javascript: 15
    Number of meta tags: 4
  9. www.kgttubi.com
    Italy - 81.25.102.1
    Server software:
    Technology: Html
  10. TAO Clean
    TAO Clean is home of elegant modern personal electronics including the World's Cleanest Toothbrush - now available as an electric brush in both black & white.
    Ottawa (Canada) - 23.227.38.32
    Server software: Microsoft-IIS/7.5
    Technology: AJAX Libraries API, CSS, Flexslider, Html, Html5, Javascript, Shopify
    Number of Javascript: 5
    Number of meta tags: 8

Check Other Websites